Welcome! Join Free | Member Center  | Company Center  | Sign In
Quick Access| 中文站| Help|LanguageTel: +86-400-669-2008
Latest search keywords: motor with controller mobile phone skin mobile phone unlock htc motif trimming bending mandrel games for chinamobile adult size cribs molde
msn
Home > Products > Packaging & Printing > Packaging Tray >

blister packing

8965 Products
Processed in 0.2907 second(s)
Others:
Select  to
or

Currently, there are about 8965 pieces of information about the excellent blister packing manufactures and blister packing on GongChang.com. You can select the ones you are interested in for future negotiation. Meanwhile, we also provide the blister packing-related information about the suppliers and product information such as:

pvc blister packing blister packing machine blister packaging automatic blister pack blister box blister food box plastic tray packing for mobile chargers blister packing for cases food blister packing plastic blister packing blister packing for medical plastic packing back pack hot pack cold pack flat pack cooler pack pvc blister

Blister Packing Machine(DPT130A ISO9000)

2011/11/02
This blisterpacking machine adopts1, Internal contact roller heater, so the heating is reliable,it will not lose blister when it restarts...

Jinzhou Chunguang Packaging Mach...   Jinzhou Chunguang Packaging Machinery Co.,Ltd.

  • China (Mainland)
  • China (Mainland)
Blister Packing Machine(DPT130A ISO9000)

Blister Packing Machine(DPP250)

2011/11/02
Parameters of the machine:This packing machine is suitable for aluminum-piastic,double aluminum, sealed packing of capsule,tablet,sweet...

Jinzhou Chunguang Packaging Mach...   Jinzhou Chunguang Packaging Machinery Co.,Ltd.

  • China (Mainland)
  • China (Mainland)
Blister Packing Machine(DPP250)

packing machine(Automatic Blister Packing Machine,Ca...

2012/05/14
Capability and Characteristic:1Heating board temperature control detection, overload protection for main motor,PVCand PTP packaging...

Shanghai Aligned Manufacturing &...   Shanghai Aligned Manufacturing & Trading Co., Ltd.

  • China (Mainland)
  • China (Mainland)
packing machine(Automatic Blister Packing Machine,Capsule Blister Packing Machine)

Packaging Line(HD180 Carton Machine And DPH130E Bli...

2011/11/02
Parameters of the machine:1.This packaging line can produce blister boards and pack the blister boards into the carton.Wrapper:PVC pharma...

Jinzhou Chunguang Packaging Mach...   Jinzhou Chunguang Packaging Machinery Co.,Ltd.

  • China (Mainland)
  • China (Mainland)
Packaging Line(HD180 Carton Machine And DPH130E Blister)

Liquid Packing Machine(DGS 350)

2011/10/31
1. liquid packing machine used to pack different kinds of liquid, such as jelly, chocolate, oral liquid 2. with plastic package

Jinzhou Chunguang Packaging Mach...   Jinzhou Chunguang Packaging Machinery Co.,Ltd.

  • China (Mainland)
  • China (Mainland)
Liquid Packing Machine(DGS 350)

DPB-140B-I Blister Packing Machine

2012/03/21
It is the latest scientific products for pharmaceutical factory and health care factory as well as foodstuff process factory. It is...

Shanghai Aligned Manufacturing &...   Shanghai Aligned Manufacturing & Trading Co., Ltd.

  • China (Mainland)
  • China (Mainland)
DPB-140B-I Blister Packing Machine

PBZ-250B Automatic Vial/Ampoule Blister Packing Prod...

2012/05/14
This line machineis specially for vial/ampoule labeling double feeding and packing into cartons.The line machine integrating blister,...

Shanghai Aligned Manufacturing &...   Shanghai Aligned Manufacturing & Trading Co., Ltd.

  • China (Mainland)
  • China (Mainland)
PBZ-250B Automatic Vial/Ampoule Blister Packing Production Line

DPP-420S Soft-Plastic Blister Packing Machine

2012/05/14
Thistypesoft-plasticpackingmachineismainlyusedforpaper-plastic/plastic-plasticsoftpackingformedicalapparatusandinstrumentproductssuchassy...

Shanghai Aligned Manufacturing &...   Shanghai Aligned Manufacturing & Trading Co., Ltd.

  • China (Mainland)
  • China (Mainland)
DPP-420S Soft-Plastic Blister Packing Machine

DPP-350A Automatic Blister Packing Machine

2012/03/21
Features:1.WormwheelReductor:Mainmachineoverloadingprotectwithlowernoiseandstabilerunning.2.Adjustablerangeofstroke:Canchangethestrokedim...

Shanghai Aligned Manufacturing &...   Shanghai Aligned Manufacturing & Trading Co., Ltd.

  • China (Mainland)
  • China (Mainland)
DPP-350A Automatic Blister Packing Machine

Food Packing Machine (DPP250S)

2011/11/02
Parameters of the machine:This food packing machine is suitable for aluminum-piastic, double aluminum, sealed packing of capsule, tablet,...

Jinzhou Chunguang Packaging Mach...   Jinzhou Chunguang Packaging Machinery Co.,Ltd.

  • China (Mainland)
  • China (Mainland)
Food Packing Machine (DPP250S)
Select to
or
Go to page
Hot Products: cloth, car, diagnostic, portable office containers, food, pvc cosmetic bag, mobile phone, print, led, jeans, wireless, glass, stone, crusher, mp3, doll, computer, lcd, side, main Show All jus tropical, deluxe bath spa, european leather sofa, household pr, silver tableware, fabric covered photo albums, wireless power usb adapter, sexy denim shorts, daf spare parts, magnetic dril, rectangular connectors, mtz gear, copyright, spandex tricot fabric, framed object, slim patch, Agrucultural product, gift box books binding, wall adaptor, fruit plate set Hide
Post Your Buying Leads
Category
Show More
Category
Country(Region)
Show More
Country(Region)

Tools

You may also be interested in :
Packaging Tray:
Show More
Packaging Tray:
Packaging & Printing:
Show More
Packaging & Printing:
Your Recent History
Browse Alphabetically: 0-9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Today's Products

About Us | Advertising Services|Products & Services|Friendly Links | Terms of Service | Privacy Policy | Help Center | Contact Us

Copyright©2009 - 2011 All Rights Reserved